ProSpec-MIF Human His C

  • Description
  • MIF Human His C

  • Macrophage Migration Inhibitory Factor Human Recombinant, His Tag C-Terminus
  • CYT-521

Catalogue number

CYT-521

Synonyms

Phenylpyruvate tautomerase, Glycosylation-inhibiting factor, GIF, MMIF, MIF.

Introduction

The cytokine Macrophage migration inhibitory factor has been identified to be secreted by the pituitary gland and the monocyte/macrophage and to play an important role in endotoxic shock. MIF has the unique property of being released from macrophages and T cells in response to physiological concentrations of glucocorticoids. The secretion of MIF is tightly regulated and decreases at high, anti-inflammatory steroid concentration.

Description

MIF human Recombinant, fused to His-tag at C-terminus, was cloned into an E. coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.
Macrophage Inducing Factor Human Recombinant is a single, non-glycosylated, polypeptide chaincontaining 123 amino acidsand having a molecular mass of 13.5 kDa.

Source

Escherichia Coli.

Physical Appearance

Sterile Filtered lyophilized powder.

Formulation

Human MIF was lyophilized from a 1mg/ml solution containing PBS pH-7.4.

Solubility

It is recommended to reconstitute the lyophilized MIF in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Stability

Lyophilized MIF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF should be stored at 4°C between 2-7 days and for future use below -18°C.
For long term storage it is recommended to add a carrier protein .
Please prevent freeze-thaw cycles.

Purity

Greater than 95.0% as determined by:
Analysis by RP-HPLC.
Analysis by -PAGE.

Biological Activity

Measured by its ability to bind rhCD74 in a functional ELISA.

Amino acid sequence

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPC
ALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTF
ALEHHHHHH.

Usage

ProSpec’s products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Related Products

  • MIF Mouse, His
  • MIF Human, Active
  • MIF Human, GST
  • MIF Mouse
  • MIF Human His N
  • MIF Human
  • MIF Rat
  • MIF T.Vaginalis